General Information

  • ID:  hor005365
  • Uniprot ID:  P82014
  • Protein name:  Diuretic hormone 1
  • Gene name:  NA
  • Organism:  Hyles lineata (White-lined sphinx moth)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Hyles (genus), Macroglossini (tribe), Macroglossinae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RMPSLSIDLPMSVLRQKLSLEKERKVQALRAAANRNFLNDI
  • Length:  41
  • Propeptide:  RMPSLSIDLPMSVLRQKLSLEKERKVQALRAAANRNFLNDI
  • Signal peptide:  NA
  • Modification:  T41 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of fluid secretion. May stimulate primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P82014-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P82014-F1.pdbhor005365_AF2.pdbhor005365_ESM.pdb

Physical Information

Mass: 543724 Formula: C205H354N64O59S2
Absent amino acids: CGHTWY Common amino acids: L
pI: 11.52 Basic residues: 8
Polar residues: 7 Hydrophobic residues: 16
Hydrophobicity: -34.88 Boman Index: -9963
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 109.51
Instability Index: 4804.15 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  10696588
  • Title:  Isolation and characterization of CRF-related diuretic hormones from the whitelined sphinx moth Hyles lineata.